SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012039 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012039
Domain Number 1 Region: 5-347
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.3e-108
Family Calpain large subunit, catalytic domain (domain II) 0.000000198
Further Details:      
 
Domain Number 2 Region: 355-499
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 8.63e-35
Family Calpain large subunit, middle domain (domain III) 0.00031
Further Details:      
 
Domain Number 3 Region: 521-634
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000436
Family Synaptotagmin-like (S variant) 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012039   Gene: ENSGMOG00000011259   Transcript: ENSGMOT00000012364
Sequence length 643
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4382:199916:229319:1 gene:ENSGMOG00000011259 transcript:ENSGMOT00000012364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTYVKAFDGQQYSTLKRQCLQSGLLFEDPRFPATDDSLFYQGNRIGRVXXXXXXQELCE
DPHLFVDGISAHDLHQGQLGNCWFVAACSSLASRESLWQKVIPDWKEQEWDTERPESYAG
IFHFRFWRFGEWVDVVIDDRLPTVDNQLVYCHSDDSNEFWSAMVEKAYAKVYGCYEALDG
GNTADALVDFTGGVSEPVDLLEGQMATDEAARNQLFERVXXXXXXXXXXXXXXXATTVED
MEARLDCGLVKGHAYAVTDVRKVRLGHGLLAFFKSEKLQMIRMRNPWGEKEWSGPWSDSS
EEWKKVSKSEREKLGVTVQDDGEFWMTFDDFCQYFTDLILCRLINTSYLSIHKTWEEEVM
RGSWVHRQDPLRNRAGGCINHKATFLQNPQYVFDVKKVEDEVLICLQQKEKRATAKEGKG
ENLAIGFDIHRVELNRKYRMHTAQQKVAGSIYINSRCVFLRKELTEGRYVIIPTIFDPGQ
QSGFLLRVFTDVPSDCKELSLDDPPQTCWTGLCGYPQLVTQVHVISAEGLQGQDSNGXXX
XXXXXXXXXXXXRSPVHKDTRSPNFDIKGLFYRKKPKEGIHIEIYNKNVIVDTFLGQVTL
FSDPNERQEQHTLHLRDKGSRQDNDLPGTLTVRLITSTTLVNI
Download sequence
Identical sequences ENSGMOP00000012039 ENSGMOP00000012039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]