SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012075 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012075
Domain Number 1 Region: 1006-1178
Classification Level Classification E-value
Superfamily Macro domain-like 2.02e-39
Family Macro domain 0.00044
Further Details:      
 
Domain Number 2 Region: 794-972
Classification Level Classification E-value
Superfamily Macro domain-like 7.4e-38
Family Macro domain 0.00047
Further Details:      
 
Domain Number 3 Region: 1401-1592
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.3e-33
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.018
Further Details:      
 
Domain Number 4 Region: 584-766
Classification Level Classification E-value
Superfamily Macro domain-like 2.86e-24
Family Macro domain 0.00092
Further Details:      
 
Domain Number 5 Region: 1309-1379
Classification Level Classification E-value
Superfamily WWE domain 0.00000000392
Family WWE domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012075   Gene: ENSGMOG00000011231   Transcript: ENSGMOT00000012401
Sequence length 1593
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2246:206833:216397:1 gene:ENSGMOG00000011231 transcript:ENSGMOT00000012401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PADGYQFMTKIFTKRFNNKKIEACRLELTKAVIVQGDMSQISEEFLTLYFSNKMSSGGDI
IKSFVHVNQNKSIVITFEDWKVAQRVAERKHTLMKKELVAQLFYPDLQWVLTGQTHLQDN
LSTDIAIPVTPDLLRFISCNEIFREELTSALQRVEAMVSFNFDSKHPQLELKMSMNKYSL
GLLRHGSSWESNARREVQTHLEKYIVEHIPMKAEVWQAVKGSCPEVNVATALIAYKICSS
ELVVVGRWEEVETLVKEIKSKMEKAIDELKVVINTIEKEIQLDSKERLDLTLDLVRDELG
NLDLSKNNENFTIHLKGLSEKVQTAETRIQEVQDTLTSKKLDSSHNLTQFLQSLDLTKFR
NDHFSLDNIVAVVICGNESVSVLAKKGDIDRAENKLKEVIKQETLSISGEYNKETFGEQW
KTFYAELKKELESTQNSQNVRIEYSGDKIELCGFRSVVDNVIAKVKGCLENKKVVTEDIT
LKTLREVEFVESFMNLPADPQLKALGVTILPCRSPQSPCLKVTATRDHIKEAIGVVNSHI
RTITTREYMYSKAGEAKILKNNNSLLKMQAKGLSCNLELSEQNITQRFSYDLKGGVTLTL
AQGNIAKQTSDVLICPLVNMSYNNPVAQQFLENGGPEIKNAIDGFEKAKQSLLAGDVIMT
NAGTLKSKKLIYAAIPVWGKSISDLNSTYLVRAVLQSLVKGSNHHCGSLGMPALGCGTFG
FPIKDSCEAIMKGINSFIGLGCGSMETIHLTESDPKTVEGFKSALERSHQNQDTTHSFLN
RCLPYCTPSISTSIKHNRFIFITPVIGRVSVILKKADITQENVDVIVNSSNQNLDLNTGS
VSGDILKAAGQSVVDECKKHGNSTSPQAVGNVALTGGGNLNCKHIAHIAGPAKTTASILQ
VLQAVERVKNVLKHCEDKNIPSVSFPAIGTGGGGMKFQDSVFALLSGIEAHFSKHKFSAL
KQIFLVHYYEEISNHTCCPNFINKDLVDDDDSSNDSSGDEDNSRGQTSTTAEMLIRPVKV
KLFCGDITKEKTDAIVSSTNTSLNLNTGVSGAILSAAGQTVVDECKILGNQPGDGVVMTK
PGNLAAKHIIHMVGQTKSKDIISSMLKVFKMCEDHKIQSVSFPALGTGVGKLCAVDVGNA
MVTAVEEHIKMTKTSLKDVHIVIFQTTMFQDFRKSLKKSKEGSVAPTQQPSMCLAGACGD
VSFPKVEVEVLGCCSSDLANVKTLVDDLVTKEWKLHQISSPYLALLLPSEKQAIVALSRS
LQVCVSVSAPDKATVSGKEADVLTMVLQIEKDLQKAKERADRQKEKKRLWKTVRWEVCDR
EAWAELAPSVSLDLEHAMDMKERRISYTLQNQTYTVNLDKMERTDRNGTIARIKRTLKAG
SEIAVIEPPRNWDRMDKKTLKIVDLSPSSEQYKKVQANFLQTSKVPKTATSATFTVVKIQ
RIQSKDQWQRYAVKKQMLEKKYPRNKNEMDLYHGTTAVICQKVNSNGFNRSFCGRNATLY
GNGTYFAKQSWYSCNDTYSNPDAQGLKYMYQARVLVGKPCLGTPGMVEPAPLDPNNPLSG
LHDCAVDNVQNPFIYVVFSDAGAYPDYLISFKA
Download sequence
Identical sequences ENSGMOP00000012075 ENSGMOP00000012075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]