SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012120 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012120
Domain Number 1 Region: 248-436
Classification Level Classification E-value
Superfamily Macro domain-like 5.55e-38
Family Macro domain 0.00047
Further Details:      
 
Domain Number 2 Region: 72-235
Classification Level Classification E-value
Superfamily Macro domain-like 3.03e-37
Family Macro domain 0.00035
Further Details:      
 
Domain Number 3 Region: 662-853
Classification Level Classification E-value
Superfamily ADP-ribosylation 9.21e-34
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.018
Further Details:      
 
Domain Number 4 Region: 570-640
Classification Level Classification E-value
Superfamily WWE domain 0.00000000183
Family WWE domain 0.0058
Further Details:      
 
Domain Number 5 Region: 1-60
Classification Level Classification E-value
Superfamily Macro domain-like 0.0000000101
Family Macro domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012120   Gene: ENSGMOG00000011231   Transcript: ENSGMOT00000012446
Sequence length 855
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2246:210442:216403:1 gene:ENSGMOG00000011231 transcript:ENSGMOT00000012446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSVPTIGTGKGGCLPEDSAKAILQGLRQHILCTPLSSLKTIFLVAFVDRTYEIIKKYFNK
PRYSKTPRAGIQIKSALVELKQGNITAETVKAIVNSTNEDVNLKNGVSGAIFNAAGSAVE
VECAKIPQGPLRGNDAGVTSGGSLQCDFIIHIVGPKSLKQAVERVKNVLKHCEDKNIPSV
SFPAIGTGGGGMKFQDSVFALLSGIEAHFSKHKFSALKQIFLVVDHFKALKECHQVLLSW
TQVTQHYYEEDLVDDDDSSNDSSGDEDNSRATTAEMLIRPVKVKLFCGDITKEKTDAIVS
STNTSLNLNTGVSGAILSAAGQTVVDECKILGNQPGDGVVMTKPGNLAAKHIIHMVGQTK
SKDIISSMLKVFKMCEDHKIQSVSFPALGTGVGKLCAVDVGNAMVTAVEEHIKDVHIVIF
QTTMFQDFRKSLKKCKKVTPTEGSVAPTQQPSMCLAGACGDVSFPKVEVEVLGCCSSDLA
NVKTLVDDLVTKEWKLHQISSPYLALLLPSEKQAIVALSRSLQVCVSVSAPDKATVSGKE
ADVLTMVLQIEKDLQKAKERADRQKEKKRLWKTVRWEVCDREAWAELAPSVSLDLEHAMD
MKERRISYTLQNQTYTVNLDKMERTDRNGTIARIKRTLKAGSEIAVIEPPRNWDRMDKKT
LKIVDLSPSSEQYKKVQANFLQTSKVPKTATSATFTVVKIQRIQSKDQWQRYAVKKQMLE
KKYPRNKNEMDLYHGTTAVICQKVNSNGFNRSFCGRNATLYGNGTYFAKQSWYSCNDTYS
NPDAQGLKYMYQARVLVGKPCLGTPGMVEPAPLDPNNPLSGLHDCAVDNVQNPFIYVVFS
DAGAYPDYLISFKAS
Download sequence
Identical sequences ENSGMOP00000012120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]