SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012125 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012125
Domain Number 1 Region: 137-328
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.08e-34
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.018
Further Details:      
 
Domain Number 2 Region: 4-125
Classification Level Classification E-value
Superfamily Macro domain-like 2.52e-31
Family Macro domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012125   Gene: ENSGMOG00000011231   Transcript: ENSGMOT00000012451
Sequence length 329
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2246:213156:216397:1 gene:ENSGMOG00000011231 transcript:ENSGMOT00000012451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTAEMLIRPVKVKLFCGDITKEKTDAIVSSTNTSLNLNTGVSGAILSAAGQTVVDECKIL
GNQPGDGVVMTKPGNLAAKHIIHMVGQTKSKDIISSMLKVFKMCEDHKIQSVSFPALGTA
VIEPPRNWDRMDKKTLKIVDLSPSSEQYKKVQANFLQTSKVPKTATSATFTVVKIQRIQS
KDQWQRYAVKKQMLEKKYPRNKNEMDLYHGTTAVICQKVNSNGFNRSFCGRNATLYGNGT
YFAKQSWYSCNDTYSNPDAQGLKYMYQARVLVGKPCLGTPGMVEPAPLDPNNPLSGLHDC
AVDNVQNPFIYVVFSDAGAYPDYLISFKA
Download sequence
Identical sequences ENSGMOP00000012125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]