SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012300 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012300
Domain Number 1 Region: 84-259
Classification Level Classification E-value
Superfamily HAD-like 4.13e-58
Family NLI interacting factor-like phosphatase 0.000000162
Further Details:      
 
Domain Number 2 Region: 53-62
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000811
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012300   Gene: ENSGMOG00000011507   Transcript: ENSGMOT00000012628
Sequence length 265
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2026:275732:281738:-1 gene:ENSGMOG00000011507 transcript:ENSGMOT00000012628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESSIITQVQKEDVQVSPKTGAVSRSSLKQPKSCNIFKALFCCLKAQDGPKLPPPPPPPP
PPSSQHALLESQENGTVVKDEGSLLPELDPQDQGKICVVIDLDETLVHSSFKPISNADFI
VPVEIEGTTHQVYVLKRPYVDEFLQRMGELFECVLFTASLAKYADPVTDLLDQGSVFRAR
LFRESCVFHQGCYVKDLSRLGRDLRKTLILDNSPASYIFHPENAVPVLSWFDDVDDVELL
NLLPVFEDLSQADNVYTRLDQLRGP
Download sequence
Identical sequences ENSGMOP00000012300 ENSGMOP00000012300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]