SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012310 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012310
Domain Number 1 Region: 6-127
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.29e-30
Family Hormone receptor domain 0.0000323
Further Details:      
 
Domain Number 2 Region: 82-381
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000229
Family Rhodopsin-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012310   Gene: ENSGMOG00000011510   Transcript: ENSGMOT00000012638
Sequence length 414
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_377:580475:618405:1 gene:ENSGMOG00000011510 transcript:ENSGMOT00000012638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDATIYQIILGEFGDLNCSLMDAFQDTFYENISFSLLNIDGSYCNATTDEIGTCWPRSST
GRMVERPCPEYINGVKYNTTRSAYRECMDNGTWAERSNYSSCEPILEEKRKYPVHYKIAL
IINYLGHCISVGALVVAFILFLCLRSIRCLRNIIHWNLITTFILRNVMWFLLQLIDHNIH
ESNEPWCRLITTIYNYFVVTNFFWMFVEGCYLHTAIVMTYSTDKLRKWVFLFIGWCIPCP
IIVAWAIGKLYYENEQCWFGKEPGKYVDYIYQGPVILVLLINFVFLFNIVRILMTKLRAS
TTSETIQYRKAVKATLVLLPLLGITYILFFVNPGEDDISQIVFIYFNSFLQSFQGFFVSV
FYCFLNGEVRSAVRKRWHRWQDNHALRVRVARAMSIPTSPSRISFHSIKQTTAM
Download sequence
Identical sequences ENSGMOP00000012310 ENSGMOP00000012310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]