SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012335 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012335
Domain Number 1 Region: 7-127
Classification Level Classification E-value
Superfamily Hormone receptor domain 3.27e-28
Family Hormone receptor domain 0.00055
Further Details:      
 
Domain Number 2 Region: 81-408
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000011
Family Rhodopsin-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012335   Gene: ENSGMOG00000011531   Transcript: ENSGMOT00000012663
Sequence length 515
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_377:657063:675015:1 gene:ENSGMOG00000011531 transcript:ENSGMOT00000012663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VYADDVLTKDEQIGLLFKAKRMCEGNIISKQIFPDGFCSPEWDGIVCWPEGAPGELVSTA
CPEYIHDFNHQGLAYRRCDNNGTWELAATNNKTWANYSECAKFFPHYNHNHEKEVFHRLY
IIYTVGYSISLGSLMVAVGILGYFRRLHCTRNYIHMHLFVSFMLRAISIFVKDVVLYSGS
AMEDMERVTVEDLKSITEAPPADKTQFIGCKVVVTVFLYFLATNYYWILVEGLYLHSLIF
MTFFSDRKYLWGFTLIGWGVPAMFVTVWASVRATLADTECWDLSAGNLTGIFQIPILTAI
VVNFVLFLNIIRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMAMPYTD
VSGIPWQIQMHYELLFNSFQGFFVAIIYCFCNGEVQAEIKKAWNRRTLALDFKRKARSGS
NTYSYGPMVSHTSVTNVTARGPLALHLTTRLGPGPVNGHRTLPGYVKNGSVSENSLPSSG
QELHVPEEEPAAARPCEEEEEKPAPLVEEERETVM
Download sequence
Identical sequences ENSGMOP00000012335 ENSGMOP00000012335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]