SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012826 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012826
Domain Number 1 Region: 59-194
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.45e-28
Family Nuclease 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012826   Gene: ENSGMOG00000011989   Transcript: ENSGMOT00000013164
Sequence length 194
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4492:535612:545634:1 gene:ENSGMOG00000011989 transcript:ENSGMOT00000013164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAVWTLKALGLGAVGLTLSVEVLGWFLRRFGSKGFLKEVIFFPTEFACVEHVFQCLCPL
PHGLETSLARLLRHVLSAKSTLDICVFAFSNMDLSRAVLALHSRGLVIRILIDKDYGCIT
GSQIGPLRRAGIRVRYDSGAVHMHHKFALVDGRRLVTGSLNWTLQAVQKNKENVMVTEEP
RLVTPFVQEFQRLW
Download sequence
Identical sequences ENSGMOP00000012826 ENSGMOP00000012826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]