SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012876 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012876
Domain Number 1 Region: 11-323
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.41e-76
Family Calpain large subunit, catalytic domain (domain II) 0.00000729
Further Details:      
 
Domain Number 2 Region: 508-645
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 9.68e-31
Family Calpain large subunit, middle domain (domain III) 0.00061
Further Details:      
 
Domain Number 3 Region: 344-490
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 1.96e-27
Family Calpain large subunit, middle domain (domain III) 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012876   Gene: ENSGMOG00000012034   Transcript: ENSGMOT00000013217
Sequence length 656
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3660:346461:353767:-1 gene:ENSGMOG00000012034 transcript:ENSGMOT00000013217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IEKCGEDGRATLFDDSDFPSDDRSLFSDCSSPLARLQDEVTWRRPQELCDCPVLFPANIN
EGHAKQGLLGDCWFLCACTFLLKNKHLMNKVCPPDQPLWGDCMYQGSFQFHIWQKGHWTM
VTIDDRLPCIGSTLCFSRCHSPTAFWVALLEKAYAKLHGSYESLWAGQVSEALVDLSGGL
AERWSLEKGGADEAEGSGQDSDRLQRRRLDLRLLRPVRDLCALSCSTHSSPGGGVDLEQY
HAMSVTEWLDVETVSGPRLTLLRIRNPWGRRGTWERACMGNEACWSSVDPALRVELQGRL
EAGEFWVDEAEFLSQFDDVTVGYPITEDGHLKSIFTGSVLSYSRQLPGRWTRGLTAGGCR
NCTSYGTNPKFWLKVSERGEVLVSLHQQGECRGNKERYAHNPLEGGPNTQPLHYQAIALH
MWKVEKKRFNLARVLNKAPSASTHCHAYEREVVLRHLQPGHYLLIPSTFLAGAQSSFLIR
AFSSGPVSLSAMRSPAGPPLPLLADSEWDHCDFQGGWVEGYSAGGSRNSPSHRKNPRFLF
SAHADAPPSPGVDVRVSLRQNRPDADLYAIGFHVYKVPEGASVMAFPLDEEPVASCVPHC
YTQDVSLACCLPAGTYAIIPSTYQPELPGSFTVSVARRIYRKVMKSQELLGNTIQE
Download sequence
Identical sequences ENSGMOP00000012876 ENSGMOP00000012876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]