SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013143 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013143
Domain Number 1 Region: 124-272
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0000000022
Family Phospholipase D 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013143   Gene: ENSGMOG00000012279   Transcript: ENSGMOT00000013492
Sequence length 273
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3953:3:3152:1 gene:ENSGMOG00000012279 transcript:ENSGMOT00000013492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQRLLGLNARGVKLRIASSLTNSSELRTLAEHXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXRKELGVVLTDCSCLALDLHRVFSFYWQLQHRDYIPSIWSRKVLAL
WGRQEPLELSLNASAAAAYLSSSPDSFCPKGRSRDVEAVQQVIRSAQTFLLISVTDXXXX
XXXXXXXXYWSPIDEVIREAVILRGVRVQLLISSWSHTHPLTLNFATSLTSLCVELDNCS
LEVXXXXXXEDGKDVQHGLNHNKYIVTDNAVYI
Download sequence
Identical sequences ENSGMOP00000013143 ENSGMOP00000013143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]