SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013548 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013548
Domain Number 1 Region: 286-383
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.49e-24
Family Canonical RBD 0.002
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000013548
Domain Number - Region: 123-362
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00549
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013548   Gene: ENSGMOG00000012660   Transcript: ENSGMOT00000013905
Sequence length 400
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4660:17543:22564:-1 gene:ENSGMOG00000012660 transcript:ENSGMOT00000013905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALNIGEERLKEMEAEMALFEQEVLGGPVSAGGPDTLDAVPVTVPVVRAIIGTNTYRQVQ
QTLEAARAATYIPPSGFVGPVPPGMPPPPPMMRPAFMPHILQRPGVPRMALMRGPPPQGM
MAPPLPRPPPPPPMMLPPSIQRAPQAAPQPMQPTCCLQQARNIAPMNPAPPPRPEAPRLK
PSPSIIQAAPTTYSSPPTPASGPRRPDIRAQRQARMEELAARVAEQQAAVMAAGLLEKKE
GGEGQIGPAMPDPEPSQSEPAESATEDKKKGKVEKVKKCIRTAAGTTWEDQSMLEWETDD
FRLFCGDLGNEVNDDILARAFSRYPSFLKAKVVRDKRTGKTKGYGFVSFKDPNDYVRAMR
EMNGKYVGSRPIKLRKSMWKDRNMEVVRKKQREKKKLGLR
Download sequence
Identical sequences ENSGMOP00000013548 ENSGMOP00000013548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]