SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013812 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013812
Domain Number 1 Region: 637-934
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 4.84e-90
Family Formin homology 2 domain (FH2 domain) 0.00000000981
Further Details:      
 
Domain Number 2 Region: 56-409
Classification Level Classification E-value
Superfamily ARM repeat 2.14e-84
Family Diap1 N-terninal region-like 0.0000000302
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000013812
Domain Number - Region: 508-562
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00602
Family beta-sandwich domain of Sec23/24 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013812   Gene: ENSGMOG00000012901   Transcript: ENSGMOT00000014174
Sequence length 1036
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2885:14228:366717:1 gene:ENSGMOG00000012901 transcript:ENSGMOT00000014174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDRFASIRIPGSRKERPHLPHAKHGSTDWSAPSSTSSSTISQLEELSSKITSEKEILALF
EKMMEDMNLNEDKKVPLRHKDLTMKREMVIQYVFTASKTGSLRSSHQISPQEFLGELKSG
VMDERLLACLDSLRVSLTSNPVSWVQGFGHEGLGLLLDVLERLLSRKXXXXXXXXXXXXX
XXXXXXXXXXXYGLERILGEEKSLALLALAIEPSQSAMMTDAVKLLSAICIVGEENTLEK
VLEAITAAGEKRAIERFAPIVQGLRDRSVQLQVACMQLINALVTSPDELDFRLHLRNEFM
RCGLKEILPHLSSTRNEALEIQLKVFEENKEEDMMEFSHRLEDIRCEITYPFVVQSMAKD
SSAENYFLSILQHLMLIRNDYLARPQYFKIIEECVSQIVLHRSGTDPDFSYRKRLDVDFS
HLLDVCVDQARIDEYEQRASELAQKSEEDFLSRQETQAELLKCEEKITELXXXXXXXXXX
FGAAPGALTSAASLVSMDLLPSAAPGCPPPPPPPPPPPPLPGCGVPPPPPPPFGAPPPPP
PPPGMASLLGSPKPLVLPYGLRPKKEFKLETSMRRLNWSKXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXRREEEDLEDRKPLKKRIKELKVLEPKIAQNLSIFLGSFRMP
YEEIRRMIVEVDEEQLTESMIQNLVKHLPEPEQLAALAKYQQEYSSLSEPEQFVLVMSSV
KRLRPRLSHLLFRMQFEEQVSNLRPDILAVSAACDEVRKSRSFSRLLELVLLLGNYMNSG
SRNAQSYGFDLSSLCKLKDTKSADQKTTLLHFLARVCEEEFGDVVKFVEELEHVDRASRV
SAENLEKSLVQMERQLLQLEKDLKTFSSSDLPQDMFLTKIFATHAREQYAKLVVLQGNMD
AQYQSMVQFFSIDPKKTSVEELFNDLSNFRTMFIXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXFSENEETGVMDSLLEALQSGAAFRDRRRRAPRPRQKI
ISPGSFRQVLRPVQPG
Download sequence
Identical sequences ENSGMOP00000013812 ENSGMOP00000013812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]