SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014087 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014087
Domain Number 1 Region: 43-173
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.46e-48
Family Regulator of G-protein signaling, RGS 0.00000996
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014087   Gene: ENSGMOG00000013171   Transcript: ENSGMOT00000014450
Sequence length 178
Comment pep:known_by_projection scaffold:gadMor1:scaffold01964:41985:43161:1 gene:ENSGMOG00000013171 transcript:ENSGMOT00000014450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIFLSLHSGKNFMCRLQCMFSHTSSSERKASGSLFPSMVFCRLSLEDTQQWSQSLERLLE
SKYGLATFRTFLKSEFSDENIEFWLTCEDYKKIKSSFRMSSRAKKIYEQFIRAESPKEIN
IDHHTREQIKRSVKAPTLYCFDDAQKIVYGLMERDSYPRFLRSDFYKTLLENLTADAT
Download sequence
Identical sequences ENSGMOP00000014087 ENSGMOP00000014087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]