SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014437 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGMOP00000014437
Domain Number - Region: 12-19,97-104
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0706
Family Formin homology 2 domain (FH2 domain) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014437   Gene: ENSGMOG00000013510   Transcript: ENSGMOT00000014811
Sequence length 201
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1991:320160:324874:-1 gene:ENSGMOG00000013510 transcript:ENSGMOT00000014811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGRMPWKVSKQPPAPPPPPAAVVIYHEKQRRELCALHALNNVFQDGTAFSRDALQEISQR
LSPSTLVTPHKKSMLGNGNYDVNVIMAALQTRGFEAVWWDKRRDVGSIAVANVTGYILNV
PSNLRWGPLRLPLKRQHWIGVREVGGVYYNLDSKLRGPHPIGSADELRKFLRHQLRGKNC
ELLLVVSEEVESHQTWMSHNS
Download sequence
Identical sequences ENSGMOP00000014437 ENSGMOP00000014437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]