SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014623 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014623
Domain Number 1 Region: 116-201
Classification Level Classification E-value
Superfamily WWE domain 8.24e-25
Family WWE domain 0.0011
Further Details:      
 
Domain Number 2 Region: 34-121
Classification Level Classification E-value
Superfamily WWE domain 1.31e-21
Family WWE domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014623   Gene: ENSGMOG00000013676   Transcript: ENSGMOT00000014999
Sequence length 320
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4385:295189:299528:-1 gene:ENSGMOG00000013676 transcript:ENSGMOT00000014999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIVSGSCVRVNGSRSGPSVSASPAGTVGQSQPMIAVWEWQDDLGHWRPYSGQVSGHIER
SLTPRQGPSGGGPSPTSICLGQSDPTLSPYLIDVPSLKQFRQDTGKTRSVRRSLFPQSSG
LGSGVYWEWANDEGGWTPYETRTSILLEHSYQARQGTADLGLHGYNYIVDLTSLAQVNKA
SGFRRQVRRQCSLPYPLASAGHAAGPSGPACSCHQCLSHSSTGPMPSRSRHSLSSNQLNR
PSLQGPGRAVAAHPASVYSPYPRRPLSVGGLSWGSPWPPPSTGAQASGPMQSNSGSVNGL
SVPAIPVQLSGSTSMTSALA
Download sequence
Identical sequences ENSGMOP00000014623 ENSGMOP00000014623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]