SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014659 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014659
Domain Number 1 Region: 107-240
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.69e-32
Family DEP domain 0.006
Further Details:      
 
Domain Number 2 Region: 18-101
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.37e-25
Family DEP domain 0.0014
Further Details:      
 
Domain Number 3 Region: 300-344
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000142
Family PDZ domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014659   Gene: ENSGMOG00000013707   Transcript: ENSGMOT00000015035
Sequence length 344
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1452:16614:32207:-1 gene:ENSGMOG00000013707 transcript:ENSGMOT00000015035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELERMAEVLVTGEQLRLRLHEAKVIKDRRHHLRTYPNCFVAKELIDWLMEHKEASDRDTA
IRIMQKLLDQSIVHHAVCDEHREFKDLKLFYRFRKDDGTFPLDHEAKVFMRGQRIYEKLM
NMENNLLQTREEEDGAYEQTLVASEFIDWLLQEGEIATRQEAEQLGRRLLEHGIIQHVSN
KHHFSDGPLLYQFRMNFRRRRRLMELLAERGRIPESHDSPFCLRKQNSDGGNTSFLSVSP
TKEIKVVVGARRSSMSSSCGSSGYYSSSPTLSSSPPVLFNPQVLIVLKRQISPEELQAPG
GAFTKKTVTIVGDAVGWGFVVRGTKPCHIQAVDPSGPAAAAGMK
Download sequence
Identical sequences ENSGMOP00000014659 ENSGMOP00000014659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]