SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014730 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014730
Domain Number 1 Region: 17-110
Classification Level Classification E-value
Superfamily Cap-Gly domain 9.29e-32
Family Cap-Gly domain 0.0000207
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000014730
Domain Number - Region: 947-1061
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00366
Family Hemolysin E (HlyE, ClyA, SheA) 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014730   Gene: ENSGMOG00000013751   Transcript: ENSGMOT00000015110
Sequence length 1274
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4155:2566:42757:-1 gene:ENSGMOG00000013751 transcript:ENSGMOT00000015110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTSPLISRMSSGGGIESGRPAKVGSVVEVIGKGQRGTVAYVGATLFASGKWVGVILDEAK
GKNDGTVQGKRYFTCEENHGIFVRQSQIQLVEDGSAATSPETPDSVTSKIPRQRDIPETP
RATKQTPVSIKKLSPPPPQPAPRRSAKFRSFFFLSLSLQTPRATFSSSSSLLSDVSEAGL
SSSQGALAAPVVPQPSGSPSATATLAPAPSGPTKEEDSLRAQVKDLEEKLETLKMKRAED
KVKVKELEKHKIQLEQLQEWKTKMQEQQLDLQKQLKEAKKEAREAVEGKERYMEEMSDTA
DAIEMATLDKEMAEERAESLQVEVDSLKEKMEELSMDLEILKHEIEEKGSDGAASSYHVR
QLEEQNGRLKEALVRMRDLSSSEKQEHVKLQKQMEKKSTELETLRGQKEKLLAETKVAEA
TIDELKEQVDAALGAEEMVETLTERNLDLEEKVRELRETVVDLEAINEMNDELQENARET
EMELREQVDLSGAKVREAGQRVEASQETLADYQQTISKYRELTASLQETNRELTNAQNTN
AEDQAPTELFDFKIKFAETKAYAKAIEMELRKMEVGQANRQVSLLTSFMPDSFLRHGGDH
DCLLVLLLIPRLICKAELISKQAQEKFDLNGNVLKGPEMRGPPGEQLSFASGLVYSLTLL
QSTLHKYEQALGGCSVEVFKLMGTLYSEMSVHERSLDYFIDLLHKDQLDETVQTEPLTRA
IKYYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVAETLAECRRQLTRVVAVLQE
LAAAGAQMMAPLAEQDGLQALRLEDVAFKAVEKVYGPQDLNPQDCLHQSCCAVIATMNKM
ATAMQEGEYDAEKPQGKVPPVEARAAAVRAEMTDAEGLGVKLEDRETIIKELKKSLKIKG
EELSEASVRLSLLEKKLDTSTRDADERVERIQTKLDDTHSLLKKKEKEFEETMDALQADI
DQLEAEKAELKQRLNNQSKMTIEGLRGQQAASGIASIVQGAAVPGGCGMAPAVAGPMQVV
DSPLLRQQVDAQRLGMRHLKNENIRLKAEKMRAQLASLAPLCPPRLPQITSEGSTSTESL
NTAIYRRTDQLQATLLKLSSQVKVVDITGKTPGGFSASAQLLEQTARLKSFSDAVDRLKG
EVAEHVVSHQPGAKVASDFSTFPVSSFTKAREERQEGAVLVGRVAIPCPRGQEQTHRLVL
SQLQLQQVHRLLMV
Download sequence
Identical sequences ENSGMOP00000014730 ENSGMOP00000014730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]