SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000014773 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000014773
Domain Number 1 Region: 155-234
Classification Level Classification E-value
Superfamily Homeodomain-like 8.98e-26
Family Homeodomain 0.00022
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000014773
Domain Number - Region: 96-103,138-143
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0863
Family Formin homology 2 domain (FH2 domain) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000014773   Gene: ENSGMOG00000013841   Transcript: ENSGMOT00000015154
Sequence length 422
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1730:42607:45977:-1 gene:ENSGMOG00000013841 transcript:ENSGMOT00000015154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKATYYDSSAIYTGFPYQSANGFSYDANQVQYPRASHVESEYHRPACSLQSPDGSVALQ
KQGEMAESCDRTSAIQAAQSTVHPESNQAQVSVSGPPPPPPPPQSPDAVAQNTSNGSNQP
ACVKNGSPTSSARSKQIFPWMKESRQNTKQKPTSSTSSVESCPGDKSPPGSAASKRARTA
YTSAQLVELEKEFHFNRYLCRPRRVEMANLLSLTERQIKIWFQNRRMKYKKDQKGVGMMP
SPGGQSPRSPGGPGSANGGGGGYLNSMHSLVNSVPYESQSPTSYNKPHQNAYGIATSYPP
PLNSSLNNCPPSQKRYAGTDSATPEYDAHPLQGNGNYGTHMQSSPVYVGGGYIDSIANSG
PSVFGLTHLSHPPSANMDYNGAITMGTNSHHHGVCDPNPTYTDLTPHYSQGRIQEAPKLT
HL
Download sequence
Identical sequences ENSGMOP00000014773 ENSGMOP00000014773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]