SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015452 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015452
Domain Number 1 Region: 68-206
Classification Level Classification E-value
Superfamily L domain-like 9.07e-37
Family Ngr ectodomain-like 0.0049
Further Details:      
 
Domain Number 2 Region: 228-330
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000163
Family I set domains 0.05
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000015452
Domain Number - Region: 381-414
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00246
Family Hormone receptor domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015452   Gene: ENSGMOG00000014421   Transcript: ENSGMOT00000015847
Sequence length 1336
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2288:647:49821:-1 gene:ENSGMOG00000014421 transcript:ENSGMOT00000015847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVRLPPPADMLRLLVVLLLLGSGAAVSYSDCKPYNERTKGSEPSTDDKKVFCSNIELDQV
LPFDSFPNRTVTLILSNNKIQELKNGSFVGLTILERLDLRNNLISRIEPGAFLGLPALKR
LDLSNNRIGCLNVDIFKGLTSLVRLNLSGNIFSSVAQGTFDSLVSLKTLEFSTPYLLCDC
SLRWLQRWVTEHSVTVKDTRCSYPRSLKGQLATDVQPESLTCDAPLELPSFLLTPSQRQV
VFQGDSLPFQCQASFVAQDMQVLWYQDGRAVEPDAAQGIAIEKSMVQNCSLIASALTISN
IQPGSTGNWECRVRTSRGNTNRTVHIVVLESSAKYCSPERQVNNKGEFXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXQRAWRRCDRAGVWADEDYSLCQYHKDITRFLNVINQMPLN
ETNVMQRARRLLVYTQNAANFSDKMDIVFVAEMFEKFSKFAEKFKDLGEVMVSMASNLML
ADDRVLWLAQRDARACTRVVSCLQRIAANLVVNAQAFSLTSPNIALEVHPVRAGEWSGMA
CVLFQKPGLEQLTFKCNATNAFASILHKNTVLEASLQLPSSLLQSPAAAAVAGQTDDSIA
NFKFYLLAFRNGKFFPSTGNSTLLADGGKRRSVATPVVMAKIXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLSSVELF
SPSIQPLHPVTYATGLVLLVCMLTIIISYVHHHRSVRVSRKFWHMLVNLCLHIFLTCGVF
IGGINQTRYISVCQAVGILLHYSTLATTLWVGVTARNIYKQVTRKAKRYEELDEPPPPPR
PMLRFYLIGGGIPIIVCGITAAANIKNYGSRINAPYCWMAWEPSIGAFYGPVGFIVFVDC
MYFLSILLQLHRHPERRYELRELGEDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQPKWYGLNLVTGRTDEEGQVALLLNTD
STPGIKTGLWKHETTV
Download sequence
Identical sequences ENSGMOP00000015452 ENSGMOP00000015452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]