SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015587 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015587
Domain Number 1 Region: 4-164
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-45
Family SPRY domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015587   Gene: ENSGMOG00000014575   Transcript: ENSGMOT00000015983
Sequence length 165
Comment pep:novel contig::contig400752:554:1090:1 gene:ENSGMOG00000014575 transcript:ENSGMOT00000015983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGCRLLLDGYTANEELALSQYNRMVTRDTKDRSYHDRPERFDSLHQVLCREGLTGRCYWE
VERDGCVEIGVTYSGIPRKGNGGSLARHNQAWCLYCRDDRYTACHNGSKSRIRVGVYLDQ
TAGTLSFYRVSSDTLKHIHTFQSTFTEELYPAFGMCGYGSSVKLC
Download sequence
Identical sequences ENSGMOP00000015587 ENSGMOP00000015587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]