SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000015965 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000015965
Domain Number 1 Region: 157-360
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.89e-53
Family Prokaryotic proteases 0.000000582
Further Details:      
 
Domain Number 2 Region: 393-488
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-17
Family HtrA-like serine proteases 0.0014
Further Details:      
 
Domain Number 3 Region: 25-106
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000152
Family Growth factor receptor domain 0.0022
Further Details:      
 
Domain Number 4 Region: 92-139
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000033
Family Ovomucoid domain III-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000015965   Gene: ENSGMOG00000014906   Transcript: ENSGMOT00000016373
Sequence length 492
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_161:867:12598:-1 gene:ENSGMOG00000014906 transcript:ENSGMOT00000016373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NMQVLLFATVLLHLNHFANAELKASKCPARCDVSSCPSPSCPSGYVPDRCNCCLACAQAE
GEPCSRKDELPCGEGLECKHPAGKRLFPLKGVCQCRQGHKICGSDGKTYGNSCQQKAASR
EALQKGRPAIEQAHKGPCESSTASIGVSHPTSPRYKFNFIADVVEKIAPAVVHIELFLRH
PLFGRNVPLSSGSGFVMSDTGLIVTNAHVVSSSSALSGQQQLKVQMCDGDVYEANIKDID
KKSDIATIKINPSKRLPMLSLGHSADLRPGEFVVAIGSPFALQNTVTTGIVSTAQRDGKE
LGIRDSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVAAGISFAIPSDRITRFLNE
SVDKHSKGXXXXXXXXXXXXXXSISEVRSVKKRFIGIRMLTITPTLVEELKQQNPDFPQV
AKGIYVHEVVAQSPAQKGGIRDGDIIVKLNGRPLLTTADLQGALLEESSLLLEVRRGNDD
LLFNIEPDVIMQ
Download sequence
Identical sequences ENSGMOP00000015965 ENSGMOP00000015965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]