SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000016327 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGMOP00000016327
Domain Number - Region: 156-284,343-372
Classification Level Classification E-value
Superfamily YWTD domain 0.000549
Family YWTD domain 0.026
Further Details:      
 
Domain Number - Region: 491-535
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0419
Family Hormone receptor domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000016327   Gene: ENSGMOG00000015205   Transcript: ENSGMOT00000016743
Sequence length 1535
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3151:336947:479834:-1 gene:ENSGMOG00000015205 transcript:ENSGMOT00000016743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFSRAPIPMAVVRRELSCESYPIELRCPGTDVIMIESANYGRTDDKICDADPAQMENTRC
YLPDAYKIMSQRCNNRTQCAVVAGPDVFPDPCPGTYKYLEVQYECVPYKVEQKVFLCPGL
LRGVYQSEHLFESDHQSGAWCKDPLQASDKIYYMPWTPYRTDTLTEYSSKEDFVAGRPTT
TYKLPHRVDGTGFVVYDGALFFNKERTRNIVKFDLRTRIKSGEAIIANANYHDTSPYRWG
GKSDIDLAVDENGLWVIYATEQNNGRIVISQLNPYTLRVEGTWDTAYDKRSASNAFMVCG
VLYVVKSVYEDDDNEATGNKVDYVYNTELSRDGHLDIAFPNSYQYIAAVDYNPRDNLLYV
WNNYHVVKYSLDFGALDNRLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVEN
CIAMVMADVSWPRTTQGLAARMPCPPGTLGVATYTCVGPEGYWDPQGPDLSNCTSPWVNI
ISQKIKAGETAAAIARELAEQTKSNLQAGDITSTVRHMVQLVDLLDVQLRNLTPGGKDSA
ARSLNKLQKRERSCRFYVQAMVETVNNLLQPTAQAAWRGLSTGAQLRAATTLLDTVEQGA
FVLADNLLKTDIVQENTDNIQLEVARMSTDGTLPDLRFPQSGGQGNSIHLSANTLKQHGR
NGEIRIAFVLYKHIGAYLSTENASVKLGHEAMATNHSVIVNSPVITAAINKDANKVYLSD
PVIFTMRHLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXNKDPIHDMLLDVITWVGILLSLVCLLISLFTFCFFRGLQSDRNTIHKNLCI
SLFIAESLFLVGINRADQPXXXXXXXXXXXXXXXXXXXXXXXXXVQLYIMLVEVFESEHS
RRRYFYLVGYGVPALIVAVSAAVDYRSYGTDRVXXXXXXXXXXXXXXXXXXXXXXXLSIL
QLNVIFLGIALYKMFHHTAILKPDSGCLDNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPGAMANH
LIPNSLLRPHGTNNPYNTLLGESSIYNNPLGMYNTQEGILNNARDTSVMDTLPLNGNHGN
SYSIASAEYMSDCVQIIDRGFNHKETTLEKKILKELTSNYIPSYLNNTHDRSAEQNRNLM
NKLVNSVSNGGKDSGYGMGLGMGMAMNMALGLDDHHHATFGPHRDEGLGLELIREESVVP
LLPQRPPLMLPPPLQPSESLHNHLHPSAPPPRIPQENSDSFFPLLANEHAREEGXXXXXX
XXXXXXXXXXXXXXXXXXXSAASADGGDSKSQEAGSDDVYYKSMPNLGSRNHLHQLHSYY
QLGRGSSEGFIVSPNKEDLAPGEPEREPSHLVTSL
Download sequence
Identical sequences ENSGMOP00000016327 ENSGMOP00000016327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]