SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017172 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000017172
Domain Number 1 Region: 1236-1414
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-48
Family DBL homology domain (DH-domain) 0.0000000615
Further Details:      
 
Domain Number 2 Region: 1805-1962
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.26e-36
Family DBL homology domain (DH-domain) 0.0000399
Further Details:      
 
Domain Number 3 Region: 1424-1540
Classification Level Classification E-value
Superfamily PH domain-like 7.09e-31
Family Pleckstrin-homology domain (PH domain) 0.00000363
Further Details:      
 
Domain Number 4 Region: 260-396
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-20
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 5 Region: 1053-1189
Classification Level Classification E-value
Superfamily Spectrin repeat 3.22e-16
Family Spectrin repeat 0.0078
Further Details:      
 
Domain Number 6 Region: 482-619
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000278
Family Spectrin repeat 0.0076
Further Details:      
 
Domain Number 7 Region: 2174-2231
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000166
Family SH3-domain 0.00053
Further Details:      
 
Domain Number 8 Region: 2070-2135
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000112
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 9 Region: 9-156
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000051
Family CRAL/TRIO domain 0.016
Further Details:      
 
Domain Number 10 Region: 1600-1664
Classification Level Classification E-value
Superfamily SH3-domain 0.00000152
Family SH3-domain 0.0051
Further Details:      
 
Domain Number 11 Region: 163-295
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000749
Family Spectrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000017172
Domain Number - Region: 626-743
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0166
Family Spectrin repeat 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017172   Gene: ENSGMOG00000015929   Transcript: ENSGMOT00000017600
Sequence length 2231
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2018:9:84327:1 gene:ENSGMOG00000015929 transcript:ENSGMOT00000017600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGVKAVDVLTVLREKVAFVSGGRDKRGGPILTFPARTNHDRVKQEDLSRLVTYLSTVPSE
EVGARGFTVVVDMRGSKWESVKPLLRTLQESFSTRIASALLIKPDNFWQKHKTNLGSAKL
SFETSLVSVEGLSRLVDPSQLTSDLGGSLEYDHVEWTELRLGLEEFSGAAGQLLAQLEQL
DTGLARVPEPQDVEEARRLVEEHGRLRSTVATAPIDALEREGRSLLQRMRLGPTPGEPAG
DAGGNHGSWLSGGADFQSVAPRVSSLLERLQGARAHFLQSWSDRKLHLDQSLQLHLYLQD
AAKMSEWIAHSKELFVQSLQDVGLNHQHALDLHSQHQHFTANCMNGSGNVDSVVTVATRL
AEGGHYGAERIGEVSSRLQEDWKALTTVLEERSQTLGLATAFHQGAEQSLCRSQWAESCG
DSLLPLAIPELQSSIQKHQELYEVMTSAYTQVSETGKALLDVLQRCPATPECDDPSLRPP
TATHGIMGVLHDVMQGHQEVEGAWQHRKLRLHQRLQLCVFQQDVRQVEDWVEQHGEVFLN
KHTGVGKSLHRARALQRRHDDFQQVAQNTYTNAEKLLEAAGQLARSGDCEEREIYQAAGD
LETRMQQAFIQRVEQRKLLLDLAVSFYTHTKELSAWMEGLQKQMSAELSLCPDTVDALQS
MINQQQQQQANTQDALLSVIREGEDLILQLRYSXXXXXXXXXXXXXXXPQGSSVAHVEVV
LQQLEENQAQLEDGFHHRKLRLDVFLQVRILQQCSLEVTGEMDAWIQDLQKQSQDFSTEK
LTLAQQRIHRHMERRLAINNMTFEVTQQGHDLQQYITEVIASGQXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXGEVMLSSCMLNELFGKLNNYREHEHPAPRTHQVALA
LQQRAELLVXXXXXXXXXXXXXAQTVALHWQSLMLRIEDRLKLVNASAAFYRTSQQVCGV
LESLEQEYRRDEDWCGGGARGRPERLIPLISKHTDQKEAFLKACTLARRNAEVFLKYIHR
NSVTMATISGHSLTVTGVTGVSEVTGHSRVPEQQVKGILSELLQRENRVLHFWTLKKRRL
DQCQQYLMFQNHTQQALDWLQQSGDHYLATHTSPGATVTQTQELLAEHRQFCVSAKRIQE
KVHLLIQLAESMLAKGHAHRAELRRCVAGVDKRYRDFSGRMGQYRHLLDTALGGCSQDNK
DLELDLIPNSLSDSDPEVNLSDPDHQMSDEKRRTARKKEYIMAELLQTERVYVRDLQECI
ETYLWEMTSGTDVPHGLSNKDDVVFGNLLDIHEFHNSIFLKELENYEQLPEDVGHCFVTW
ADKFHMYVTYCRNKPDSSLLVQQHGSTFFQEVQRRHGLANSISSALIKPVQRITKYQLLL
KELLACCEEGKGEIKEGLDVMLSVPKRANDAMHVSMLEGLEEGVEVQGELLLQDSFQVWE
PKSLIRKGRDRHLFLFELSLIFSKEIKDSCGRTKYIYKSRLRTSELGVTEHIEGDPCKLA
LWVGRTPTSDNKTVLKAASLELKQEWVRSVRQVIQERRGHLRGALREPIPLPKTPGPPHQ
SNRRDTSEDADSLGDASSQPDSVSIASRTSQNSDKVHKLSGGCELVVVLLDVSAGGVGEL
SVRCGQTVELVERSSERPGWCLARTTDPSPPQEGLVPLSALCLSHSHSAADMDALLXXXX
XXXXXXGGSTASPGPKRSGSSSSGTGNTLKXXXXXPVRRLSQGKADAQKKPPISSRRRDH
RPELTTPLSNPTKGRRDDSVQSGGEEEQEEQEEDPSTALPPPMEIIKDPNTPQVPSQALE
SDQSSNESDTEQRNKAMRGRMFVVSELVQSEKDYVKDLGVIVEXXXXXXXXXRGTPESMR
GKDKIVFGNVHQIYDWHRDFFQVELERCLQDQDLLAELFIKHERRLHMYVVYCQNKPHSE
FVVIQYESFFEEIQREISCRMSISDYLIKPVQRITKYQLLLKXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXVSMLALQDSVDPEPRQFVLWSRGSEERFTLQA
SAASVRTSWVEHLSQLVEAQRDFLSALQSPIEYQRKEGVVPRPLSSGRPPSAPPTPNGHA
PQPDQDTDTHEDQDLVLVLQDFSAVREDEITVVRGDRVQVLSSNQQGQSLVFRPANSESP
PAEGWVPRSVL
Download sequence
Identical sequences ENSGMOP00000017172 ENSGMOP00000017172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]