SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017578 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000017578
Domain Number 1 Region: 206-387
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.65e-46
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.031
Further Details:      
 
Domain Number 2 Region: 82-166
Classification Level Classification E-value
Superfamily WWE domain 0.000000000000235
Family WWE domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017578   Gene: ENSGMOG00000016384   Transcript: ENSGMOT00000018010
Sequence length 387
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2621:4005:7957:-1 gene:ENSGMOG00000016384 transcript:ENSGMOT00000018010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EICLYFLRQHCSFKDKCVRVHYQLPYRWQVQDSVSLSWIDMPNMETMERAYCDPYDNTVK
NLGGTVRRLSTVSSVSKPNFILTTDWLWYWQDEIGSWEEYGQDKVGDDGGSTASVNSGSL
ERTYLSEIEVESFSAGGQKYTINFKEMQQQNLHYRTKREVRRRPRFVSTQEVQDGRVISR
GIPAASSSLGDSVPANWDKTALPNFGYKVIPLTSSSPEYKKVESWFKGTMKTSLINKIER
IQNPVLWNGFQGQKTLMKAKNGGKPVDERHLFHGTEESLLDPICEQNFDWRMCGVHGTLY
GKGSYFARDASYSDKYSKAHGGLRRVMFVAHVLVGEFTLGSSSYARPPSKSTSKNLYDSC
VDCARDPSIFVVFEKQQIYPEYIIDYS
Download sequence
Identical sequences ENSGMOP00000017578 ENSGMOP00000017578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]