SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017762 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGMOP00000017762
Domain Number - Region: 25-35
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000162
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017762   Gene: ENSGMOG00000016542   Transcript: ENSGMOT00000018200
Sequence length 677
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_309:3868:39433:1 gene:ENSGMOG00000016542 transcript:ENSGMOT00000018200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APGRPGNSSKQSSTSPTPTSSTPPPPSPPPPPPPPPATSEEGALPCNITEKYWLKTVLSI
QLRRNRLDLILKQNLAKGLSHALQRALNDTNASAQXXXXXXPYNVTLAYYVTSGKTIYIA
SLVVEALNVYGFDKLLSDIRQHTPLVKAVLVPVATWLPAPSVHLQLKTVLRFIGPTDNIY
SCSFVQMLEQRLENAFDEAQDKVLETYSRLTVEIQSVSQVPASPSVAVVYVVRNQDALLN
GTISSGLLNQLTAELVGYFLFYPPLLIAEPLEYHNLNTSAATKSYWVITVIQDVDTGSLE
TSYQSFASLMEQRLAELFLVAGRQGAQVARVRRASSVGAYTVQMVSMRRLAGPKDPAEMT
YYAQLNGEPILGTAAAKTLSTLDSQTMALTLGYFVQVQAEPVVKTPPGNLWLLAVMTPVA
LLLVVLGMVAFILCKRNRVIFKTSAFRTFKTRSKPVQGFDYAKKHIGRPGDETTSVTKET
LLLALPARDAPLSLERKAYQDGTANKRPSSTDMHKGGXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPYEDHSGSLRLITI
KPMTAQPTYSYPSSSSHSQDSVVVNGESNHSGLKQKSDIEHYRNKLRQKARRKGYGEFSL
SGSGSHAHGQRDARHGR
Download sequence
Identical sequences ENSGMOP00000017762 ENSGMOP00000017762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]