SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000017828 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000017828
Domain Number 1 Region: 24-242
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.05e-44
Family DBL homology domain (DH-domain) 0.00039
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000017828
Domain Number - Region: 245-298
Classification Level Classification E-value
Superfamily PH domain-like 0.000216
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000017828   Gene: ENSGMOG00000016543   Transcript: ENSGMOT00000018267
Sequence length 303
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_169:327377:329914:-1 gene:ENSGMOG00000016543 transcript:ENSGMOT00000018267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQVTVAPPPPARFPRDRLTTFWQDLDEVKECGVLATLSPREVHRQEAMFEVIGSEASYLR
SLGVAVNHFMASKKLSRTVSPLEHHVLFSNLRHVMSASESFLVALERLLGECVVIPQLGG
LMLQHCPRFRALYVPYLSNMMFQEALVNKLLQENKGFVSALKTLERDPVCQRRSLKSFLV
LPFQRITRLKLLMESLPLGSASSKQVPHPVIFSYWKEKDQVIMECNEGVRRMKQIEELVR
LEVLLDFNNLKLLPLVVKGRFLLHDGPLRQLNRVGSDSKISFTDVHLHLFSDLLVISVQK
IPG
Download sequence
Identical sequences ENSGMOP00000017828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]