SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018138 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018138
Domain Number 1 Region: 386-749
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.38e-113
Family Motor proteins 0.000000582
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000018138
Domain Number - Region: 62-163
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0288
Family Hemolysin E (HlyE, ClyA, SheA) 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018138   Gene: ENSGMOG00000016879   Transcript: ENSGMOT00000018585
Sequence length 761
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1646:165248:187495:1 gene:ENSGMOG00000016879 transcript:ENSGMOT00000018585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLRASYRERLNDKNSIICSLEEAVSQPHTLSPLTPSEDESSISSGGLAGVQSLVASLY
GLQGERSRLRGELHLMHSQLEDKEQDRNSRILAFQQQIDDLKGGIEEREEELSRLRAASG
ATDSEKRVLCLSVENDSLKQSLSVTQGLLQQLSAIPSQSSNMLLKVYPLQENESLRGRIQ
QLETSLQERAEQLSHLERQSEKGEWRRGEELRKREDRVRELQLELDRERGKEPLVKYVTQ
TVEVESPSSVKQLSKAKQKNKLLSEKLSIQDQRCKHLEEQIRKSDEYSCNLQHKIAAYER
EISALRQELLTEIGHLEEKKEEAVKAASSCSTEHFHSLQEQFFSLQKRLTALPPALGSMK
TDYASLRSQVRNFSDFYGAAISDAKKQINAAIHEMSEANKDLMEKYMKEVALRRKYHEQL
VELKGNIRVLCRVKPVLKEDQQEEGQAVVVTTDPNNESALSVINKGKARAFELDKVFHPQ
ATQEEVFQEIGPLVTSCIDGYHVCIFAYGQTGSGKTYTMEGSVENPGINQRALKHLFNEI
EERKDMWSYTVNVSSVEIYNELLRDLLSKDGEKLDIKINPDGTGQLHVPGLRVTEVKGFQ
HIKKVLAKARRNRITFGTKMNQHSSRSHALLCITVHGTDLANGSKTTGKLNLVDLAGSER
VWKSGAEGERLKEAQNINRSLLALGDVIQALRGNQTHIPFRNSRLTYLLQDSLGKGNKTA
MVVQKVSALESNVGETLCSLKFAQKVCRVELGPAARKIESG
Download sequence
Identical sequences ENSGMOP00000018138 ENSGMOP00000018138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]