SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000018715 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000018715
Domain Number 1 Region: 33-323
Classification Level Classification E-value
Superfamily ARM repeat 5.76e-65
Family Diap1 N-terninal region-like 0.00046
Further Details:      
 
Domain Number 2 Region: 688-835
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 3.79e-41
Family Formin homology 2 domain (FH2 domain) 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000018715   Gene: ENSGMOG00000017390   Transcript: ENSGMOT00000019173
Sequence length 846
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2771:113:33044:-1 gene:ENSGMOG00000017390 transcript:ENSGMOT00000019173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPVPMAARAKWGTAKNLPAAVDADAQLDANLEDADPELCIRLLQVPTVTNYSGLLRRLQS
STTAWKVQFLELRGLDLLLEALERVSGRGCLHITDALLQLKCVACVRAVMNSKTGLDFML
DNQGYVRTLAQALDTSNMMVKMEVFRLLSCITLYTQGHQQTVDALEHYKSLKKQQYRFSV
IMNELHATDNVDYLETLMGMVNTLLHGLDDLRKRDKLRKEFIGLQLLDLLPRLRDMDDMN
LNHQCETFENSLAEDEDDMMEMYGGIDMSSHQDVFTSLFTRVSSTPASLHLLSVLQALLL
VSPNRTDVWGVLETLVDRAMLLSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXYTLRIDCMLLSEETSVVLESLMPKAQLVEQAC
KSLKNSPRLPSFCKLTLDIGNFLNYGSHTGNAEGFKISTLLKLTETKATGSRITLLHHMI
EEAEKNHPDLLKLPEDLDICDKAAGVPLESIQAEAATLIRFLENTQKKVEASSAEDLKEN
YLSAIK
Download sequence
Identical sequences ENSGMOP00000018715 ENSGMOP00000018715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]