SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019484 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019484
Domain Number 1 Region: 2-114
Classification Level Classification E-value
Superfamily Hormone receptor domain 4.71e-25
Family Hormone receptor domain 0.00031
Further Details:      
 
Domain Number 2 Region: 87-365
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000146
Family Rhodopsin-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019484   Gene: ENSGMOG00000018102   Transcript: ENSGMOT00000019959
Sequence length 368
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1484:174127:186949:1 gene:ENSGMOG00000018102 transcript:ENSGMOT00000019959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHPECEYIFQLAREEHRCLQHIAEQANHSLQGCQPFWDAVLCWPNAGEGETIHKACPAVF
SLFGNNTGSVSRNCTDQGWSIPFPQYHIACSVDDDIPETQAYFTTVKLIYTVGYGTSLAS
LSIAVLILLLFRRLHCARNFIHIQLFTTFILKAAAVFIKDTTLFSSEDTDHCNLSTFYCK
AAVVFCHYCAMTNFFWLLAEALFLNSLLLSSFYHSRRCLWGYGLLGWGVPVLFIMLWMVS
RVYFEDTECWDINDNSPYWWFIKGPIVVSIGVNFMLFLNIIRILMQKLNPRLIQFNNSSQ
YRRLTKSTLLLIPLFGSHYMVFNFLPDYFNVNMRLCVELCVGSFQGLVVAVLYCFLNQEV
QKELQVRW
Download sequence
Identical sequences ENSGMOP00000019484 ENSGMOP00000019484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]