SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000019923 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000019923
Domain Number 1 Region: 322-376
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000785
Family TSP-1 type 1 repeat 0.00056
Further Details:      
 
Domain Number 2 Region: 271-317
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000157
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 3 Region: 376-431
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000249
Family TSP-1 type 1 repeat 0.00069
Further Details:      
 
Domain Number 4 Region: 434-486
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000118
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 5 Region: 892-1064,1097-1184
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000696
Family Rhodopsin-like 0.024
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000019923
Domain Number - Region: 503-549
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.000405
Family Hormone receptor domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000019923   Gene: ENSGMOG00000018487   Transcript: ENSGMOT00000020408
Sequence length 1436
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1729:11:272743:1 gene:ENSGMOG00000018487 transcript:ENSGMOT00000020408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISSPCSSLVAGVLYGSFSLRELFPSRLPGCSWSLENPDPTKYSLYLRFTRHPSICQTHSP
MLLSLDHHLANQSCPLRLHSDPPKDQEVVDLCGGRPAADEPHAFLQFDKNFVQLCLTRRP
SPDAPPLSKETLELRLVEVLLINNENSSQFTCGVLCRWFEECLRGGRHGDGDGGDGCGMT
QTGCICPNHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXPYEDDLKVKTQRPRSADQPGVFQAQTGDPAAEEWSQWSVCSLTCGQGWQVRTRSCVSS
PYGTLCSGALRETRMCNNTVACPVHGLWEEWSSWSLCSVTCGRGSRIRTRKCVNGGGGGA
CGGPETQTKLCNIALCPVEGQWLDWAPWSPCSVTCSVGTEQRQRRCSASVHGWAECKGVH
QESRDCNNPPCSGGGNWASWNHWSLCSKTCDSGWQRRFRTCEGAEVQGSTCQGSGEEVRT
CNDKKCPAPHEICKDETLLSMTWKRASAGETVYNKCPTNATGSASRRCMLDNNGVAFWGP
PSFARCISLEYRYLHLSLREHLAKGQRTLAGEGMSQIVRGLLELLQRRSYHSGDLLFSTE
ILRNVTDTFKRATYIPAPDDVQKFFQVVSLMLDMDNIEKWDDAHQVSPGAAMLMRILEDF
IHLIGDAQKPFQSVLVVTTNLMITIQREPVSAVSSNINFPMKGRRGMKDWARNAEDKLYI
PKEVFTAPAEGRXXXXXXXXXXXXXXXXXXXLTETETETEGTMYYVIGAILYRTLGSILP
APNPPAMINSKILAVTVRPEPQPSEPMVVVELSPLLNGTSDPQCVVWDYGNPEAGAENWG
TEGCQTLTSTAVHTKCLCSRISTYAVLAQQAKDPDMGPSSMPSVPLMVGCGVSCTALIIL
LLIYAAFWSRYIRSERSIILVNFCLSILASNMLILVGQSQTLSKGLCTVTAAFLHFFFLA
SFCWVLTEAWQSYLAVIGKMRSRLIRKRFLCLGWGLPALVVAVSVGFTRARGYGTASYCW
LSLEGGLLYAFVGPAAVIVLVNMLIGIVVFNKLMSRDGISDKSKKQRAGSQSVPVEARNR
LLLKCSKCGVISSTAMSSSTASGAMASLWSSCVVLPLLALTWMSAVLAITDRRSTLFQVL
FAVFDSVQGFVIITVHCAMRREVQDAVRCRMGGCKDDSENSPDSCKNGQVQIMTDFEKDV
DLACQTVIFKEVNTCNPSTITGTLSRISLDDEDDPKLMAHQDGGVGLNGAGGRGEAPQHR
WTTPPSPRPPPLTLHPAESEAYPADFVAPGQGDMNLAMNLNHRSYGTIKTMPGHGNMLAP
GGPMAHAHRGHVQHGHSLQLKPGQRPSVRQILTRGVGAERTMTLPRNLGSTNNANTSHSA
GSLERKRVRYSELDFEKVMHTRKRHSELYHELNHSSKFHTIDRYSRDPAVSAFKVR
Download sequence
Identical sequences ENSGMOP00000019923 ENSGMOP00000019923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]