SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020246 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020246
Domain Number 1 Region: 128-229
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-34
Family Phosphotyrosine-binding domain (PTB) 0.00000544
Further Details:      
 
Domain Number 2 Region: 3-101
Classification Level Classification E-value
Superfamily PH domain-like 9.31e-26
Family Phosphotyrosine-binding domain (PTB) 0.0000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020246   Gene: ENSGMOG00000018854   Transcript: ENSGMOT00000020745
Sequence length 244
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4244:369126:371166:1 gene:ENSGMOG00000018854 transcript:ENSGMOT00000020745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YEDVQKSGYLRKHKSMHRRFFVLRAASEQGPARLEYYENEKKFRSKSPVPKKTLNLETCF
NINKRADSKNKHMIVLYTRSESFAIAADTEEVQDEWYQAMLDLQCNFKAPDDWGSSGECS
SPSPVPTFKEVWQVKVWPKGLGHARNLVGIYRLCLTDKTVNFVKLNSEVASVVLQLMNVR
RCGHSENFFFIEVGRSAVTGPGEFWMQVEDSVVAQHMHETLLEAMKALSEEFRQRSKSQS
VGTS
Download sequence
Identical sequences ENSGMOP00000020246 ENSGMOP00000020246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]