SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020446 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020446
Domain Number 1 Region: 62-194
Classification Level Classification E-value
Superfamily Macro domain-like 5.89e-52
Family Macro domain 0.0000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020446   Gene: ENSGMOG00000019016   Transcript: ENSGMOT00000020946
Sequence length 195
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_612:1409161:1727622:1 gene:ENSGMOG00000019016 transcript:ENSGMOT00000020946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKEKTDWKIEKERLLSLNLEERRKEYRRQAYTTLGDVSTWRQECKGNAKVEESEPTGGA
SDKVSLHKGDITVLEVDAIVNAANSSLLGGGGVDGCIHKAAGGCLYDECHSLNGCETGKA
KITCGYDLPAKYVIHTVGPMARGRAGPSESSDLSACYQNSLKLLVDHNLTTVAFPCISTG
IYGFPNKSAADIALK
Download sequence
Identical sequences ENSGMOP00000020446 ENSGMOP00000020446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]