SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020566 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020566
Domain Number 1 Region: 23-141
Classification Level Classification E-value
Superfamily Hormone receptor domain 5.89e-28
Family Hormone receptor domain 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000020566
Domain Number - Region: 101-398
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00146
Family Rhodopsin-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020566   Gene: ENSGMOG00000019119   Transcript: ENSGMOT00000021068
Sequence length 455
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1696:40721:53735:-1 gene:ENSGMOG00000019119 transcript:ENSGMOT00000021068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFVKASLEVNETQQQQYPTNVYHDLGVTRNKIVTAQFECYQKIMKDHNPKGPSESMCNRT
WDGWLCWEDTTAGYTSEQSCPDYFQDFDPSEMVVKICTDSGSWFLHPESNRTWTNYTRCN
ARTNEGRMTAMNLLYLAFIGHGLSVTSLIISLGIFFYFKSLSCQRITLHKNLFCSFVLNS
IITIISLTAVANNQELVQRNPTSCKVSQFVLLYLFGCNYFWMLCEGIYLHTLIVVAVFAE
KQHLMWYYLLGWGFPLIPACIHAVARSYYYNDNCWISSNTSLLYIIHGPICAALLVNLFF
LLNIVRVLITKLKVTHQAESSLYMKAVRATLILIPLLGIQFVLLPYKPAGRVSSEIYDYI
MHILMHYQGLLVATIFCFFNGEVQGILRRHWNQYRIQFGSGLGSHSDALRSASYTASSIT
EVQGCYSIDGNSEHMNGKGFHDLETSILKADNLYS
Download sequence
Identical sequences ENSGMOP00000020566 ENSGMOP00000020566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]