SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020656 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGMOP00000020656
Domain Number - Region: 472-552
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0051
Family Apolipoprotein A-I 0.012
Further Details:      
 
Domain Number - Region: 277-415
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0314
Family HBL-like 0.049
Further Details:      
 
Domain Number - Region: 128-252
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0353
Family Apolipoprotein A-I 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020656   Gene: ENSGMOG00000019200   Transcript: ENSGMOT00000021162
Sequence length 561
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_366:251564:256164:-1 gene:ENSGMOG00000019200 transcript:ENSGMOT00000021162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CAYVVQRNITCTMQDGVATYVKAEYTTKCIWGQKCPYRTFYKPTYKVGHKTITELEWRCC
PGFSRMEDNLRRLTQGLDTLNGMVVSLEDRMRTSLREDTTKIVGLGVFPEGGPAGREGFA
GLGDLEGRVTEVKNELRAKEEILDAKLAGVRADILDGFERRLTGLESHCDERIVAVQRQC
QREHVDGQEQMQQSLDGRETGIREELGTLQAQIQGLTLTESCSGGLTESQRQLQTALSDH
SVHVETLIEARLVDMEGRLNATDRAGRPGAVPGSGGFKTMLEEKLKTLEERVFVAVEELS
NATAPALLEGHVVPALETEIESVRRRVEGDLDGLQKQLIDLELLCTSSCALQPVAAGVSG
AQAEESAKKVSGRLDTIAQEETEGSVQGEITLLKVNINSVNRTLKGLRDSVSYIAKEVGH
ANTTWEQRENQLSNQMLGIARLVGHQATAFGAGERRLAQLKGELVALRRRLSGELQGCRS
STLGVQKEVKDVDSRVSQVEGQCSSLGELAEHLEKIRAELERHSDSYLAQVSGTLSDHSE
QLAELKGEIKDCAANVASTER
Download sequence
Identical sequences ENSGMOP00000020656 ENSGMOP00000020656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]