SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020745 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020745
Domain Number 1 Region: 185-319
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-39
Family SPRY domain 0.00013
Further Details:      
 
Domain Number 2 Region: 2-53
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000351
Family B-box zinc-binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000020745
Domain Number - Region: 59-153
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0128
Family HBL-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020745   Gene: ENSGMOG00000019295   Transcript: ENSGMOT00000021252
Sequence length 319
Comment pep:novel contig::contig259259:5:1035:1 gene:ENSGMOG00000019295 transcript:ENSGMOT00000021252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DRMCKKHDRLLELFCPTEQVCVCQFCTETDHKSHPVVPLKEEYEVKTAQLGKIEAEVPQL
IQKRKQKIKEIKDRVELSNKVADREIVIGGQVFTALIGCVEKCRDEFNQTVQEELKSTEK
QAEDLIKELEQEIEDLTNRCSEVKQLSHTKDHLHFLQTFRSLKDPPPTRDWTTVEMKKLH
DDAELKRVQQYEVDVTLDPDTAHRWLILSEDGKQVHDGGVRKVLPDNPKRFTYLFVLTRQ
SFSSGRFYFEVQVKDKTYWWLGVARESIDRKGGSTWTPEMGYWTLLYYKDGLVFRDNPHV
RLPLRAGLQKVVFVDYDEG
Download sequence
Identical sequences ENSGMOP00000020745 ENSGMOP00000020745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]