SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020876 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGMOP00000020876
Domain Number - Region: 84-130
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0366
Family HBL-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020876   Gene: ENSGMOG00000019407   Transcript: ENSGMOT00000021386
Sequence length 151
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2236:159061:160492:-1 gene:ENSGMOG00000019407 transcript:ENSGMOT00000021386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVGAFPIAKLLYLGVRQMSKPVANRIKAGAVRSEFFKNYVCLPPAQLYHWIEMRSKMRI
MGFRGSNIKPLNEEAAAELGAELLGEAIIFLIGTGCMVLEYSRQASNAARKEEELSQTIS
SLQTQLGELALSTEIMDAQLREVNRLLLSLP
Download sequence
Identical sequences ENSGMOP00000020876 ENSGMOP00000020876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]