SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020934 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020934
Domain Number 1 Region: 208-322,366-416
Classification Level Classification E-value
Superfamily MFS general substrate transporter 5.23e-21
Family Glycerol-3-phosphate transporter 0.044
Further Details:      
 
Domain Number 2 Region: 531-673
Classification Level Classification E-value
Superfamily MFS general substrate transporter 6.67e-20
Family Glycerol-3-phosphate transporter 0.021
Further Details:      
 
Domain Number 3 Region: 439-519
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000000105
Family Pentapeptide repeats 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000020934
Domain Number - Region: 106-164
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0017
Family Glycerol-3-phosphate transporter 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020934   Gene: ENSGMOG00000019457   Transcript: ENSGMOT00000021446
Sequence length 682
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3304:31055:58456:1 gene:ENSGMOG00000019457 transcript:ENSGMOT00000021446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEIHSGDTSLVQGARDIAKEAKRHASRTVGRSVGRASDEFSQHNNYDRFQYQGVPPRGR
DAPGRAVALGQPVPESAKDRKELENERQADEEEMAQQYELIMQECGHGRFQWQLFFVLGL
ALMSDGVEVFVVGFVLPSAETDMCVPNSGAGWLASGLSWHQVFGYTRRXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXLSIGGAVPIVFSYFAEVLAREKRGEHLSWLCMF
WMIGGIYASAMAWAIIPHYGWSFSMGSAYQFHSWRVFVVVCALPCVSAVVALTFMPESPR
FFLQNGKHDEAWMVLKHIHDTNMRARGEPERVFTVNRIKVPRQLDELVEMQSETANPVAK
AFMKVRAEIRGLWMTFMRCFSYPVRDNTVKLAVVWFTLSFGYYGLSVWFPDVIKHLQADE
YASRVKIHNGERTEDFTFNFTLENQIHRNGVFQNDRFIAMRFKAVTFIDSTFDNCYFEDV
SSVGTSFKNCTFIESFFYNTDIDDSKLTNSRVITSSFHHNKTGCQMTFDDDYSAYWVYFV
NFLGTLAVLPGNIVSALLMDKIGRLSMLGGSMVLSGISCFFLWFGTSESMMIFMLCLYNG
LSISAWNSLDVVTAEIYPTDRRGTGFGFCNAMCKLAAVLGNLIFGSLVGVSKAVPILLAS
AVLVTGGLVGLRLPDTRANVLM
Download sequence
Identical sequences ENSGMOP00000020934 ENSGMOP00000020934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]