SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000021119 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000021119
Domain Number 1 Region: 617-630,660-1038
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 5.49e-109
Family Formin homology 2 domain (FH2 domain) 0.00000000136
Further Details:      
 
Domain Number 2 Region: 45-410
Classification Level Classification E-value
Superfamily ARM repeat 2.3e-101
Family Diap1 N-terninal region-like 0.000000000309
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000021119
Domain Number - Region: 455-528
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0016
Family HBL-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000021119   Gene: ENSGMOG00000019634   Transcript: ENSGMOT00000021634
Sequence length 1136
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3631:653872:741033:1 gene:ENSGMOG00000019634 transcript:ENSGMOT00000021634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LERFTSMRVKKDKERGGPGPTQRHSTSYEPSGQSTALHDLSDESVLELFQQMLVDMNLNE
EKQKPLRQKDIGIKREMVSRYLHTSKAGQSQKESSRSAQMYIQELRSDIRDTQLLGCLES
LRVSLNNNPVSWVQNFGDEGLVLLLSLLRKLQEERDEYVCSSRLSRNVSGKCQHEIIRCL
KAFMNNKYGLKAMLATDEGIPLLVRAVNPRVPHMMVDAIKLLSAICILDHNDNLHERVLE
AITEEAERKDIERFQPLLAGMKQNSVALKGGCMQLINALISRGEELDFRVHIRSELLRLG
LRDLLMDVRTIENEELRVQLNVFDEHAEEDSEELKARLDDIRIEMEDVREVFEILFNTVK
DSKAEGHFLSLLQHLLLIRNDYLARPQYYKLMDECVAQIVLHRNGADPDFKCRNLRLDIE
GLIDNMVDQTKVKTSEAKAVELEKKLDVELTSRHELQVELRKLEADYEVRLQDLSSEKEL
LSSSKQEKDKENQGLQKKLGTLQQQIEKLSQDLVEAKTKVVTVLVPAPRPLPPAPAPPLP
GHACMPPPPPPLPGMPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXGVPPPPPGIGMPPPPPGSWAHAAPPPLPFGLQPKKEYKPEVQLKRA
NWSKIGPEDLNENSFWTKAKEGRYENNELFAKLTLAFSSATKTKKEQDGGEEKKQVQKKK
VKELKVLDSKTSQNLSIFLGSFRMPYEEIKMVILEVNEKVLTESMVQNLIKQMPDQEQLN
TLADMKDEYEDLAEAEQFAVVMSGVKRLKTRLEAILFRLQFEELLNNVKPDVVSVTAACE
ELSKSQTFAKLLEIILLVGNYMNAGSRNGKAYGFSMSYLCKLRDTKSADHKQTLLHFLAD
VCQEQYPEVMGFSDELVHVEKASRVSAEVLQKNIEQMGRQIKTLQKDLEAFPPPQNERDL
FSEKMSIFVGTAKEQHEKLELMHNNMEEQYSELGRFYVFDPRKMSVEEFFGDLKTFKTMF
EQAVKENQKRRETEEKIKRAKLAREKADKEKEEKAKKTQILDINSEGDETGIMDGLLEAL
QSGAAFRRKRGPRQAANHRRAGHAVTNLLAKELMQEHNQPDKKIKREEPMLEGAGS
Download sequence
Identical sequences ENSGMOP00000021119 ENSGMOP00000021119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]