SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000021930 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000021930
Domain Number 1 Region: 52-112
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.49e-16
Family B-box zinc-binding domain 0.00075
Further Details:      
 
Domain Number 2 Region: 268-314
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000123
Family SPRY domain 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000021930
Domain Number - Region: 118-208
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00602
Family HBL-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000021930   Gene: ENSGMOG00000020443   Transcript: ENSGMOT00000022448
Sequence length 314
Comment pep:novel contig::contig229115:74:1015:1 gene:ENSGMOG00000020443 transcript:ENSGMOT00000022448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQPCVEPAEVPCDVCTGTQQKAVKSCLMCSASFCKTHLEPHQRVAGLKKHRLVEPMDRLE
DRWCKKHDRLLELFCQTEQVCVCLLCTEADHKSHPVVPLKEEYEVKTAQLGKRGADVQQM
IQERKQKIKEIKDTVELSNKDADREIAHGGLVFTALIGCVEKCRDEFNQTVQEKLKSTVK
RAEDLIKELEQEIEDLTNRSSEVKRLSHTEDHLHFLQTFRSLKDPPPTRDWTTVEVRPPS
YVGTLRRSLDQLEETLNMETKKLCDAELKRVQKYEVDVTLDPDTAHPRLILSEDGKQVHD
GGVVRMLPHNPKRF
Download sequence
Identical sequences ENSGMOP00000021930 ENSGMOP00000021930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]