SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000968 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000968
Domain Number 1 Region: 214-299
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 0.00000000000076
Family Hypothetical protein YjcS 0.058
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000000968
Domain Number - Region: 2-35
Classification Level Classification E-value
Superfamily EF-hand 0.000235
Family Calmodulin-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000968   Gene: ENSGMOG00000000937   Transcript: ENSGMOT00000001004
Sequence length 304
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4119:23817:70070:1 gene:ENSGMOG00000000937 transcript:ENSGMOT00000001004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDGKLSLDEFQAFFSDGTLNEEELEKLFHTIDSDNTXXXXXXXXXXYFAKHMGDYEGVLA
SLETLNLSILKAMDFTKKVYERGSNVEQFVTRFLLKESANQIQSLLSSVESAVDAIDEQH
SQTGVSASQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAVEVRKEGLEQQINR
LAELIGRMENKTVWFDLHQRLTDTDGTASASLLLVRQEMVVSQKKLGEFCEALKQYLKNV
SAQRDCFHVTAVRLPDGLSFVVYEFWDGDEEWKRHLQSAPIKTFQHVKVDTLCQPEAVST
VAVP
Download sequence
Identical sequences ENSGMOP00000000968 ENSGMOP00000000968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]