SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001136 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001136
Domain Number 1 Region: 286-567
Classification Level Classification E-value
Superfamily Kelch motif 9.29e-67
Family Kelch motif 0.00000224
Further Details:      
 
Domain Number 2 Region: 14-130
Classification Level Classification E-value
Superfamily POZ domain 6.02e-34
Family BTB/POZ domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001136   Gene: ENSGMOG00000001085   Transcript: ENSGMOT00000001175
Sequence length 572
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4035:820369:827904:-1 gene:ENSGMOG00000001085 transcript:ENSGMOT00000001175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEDGIEKQGPVTLNPRHMRKAFKVMNELRSQSLLCDVTIVAEDVEITAHRVVLAAGSPYF
HAMFTGEMAESRAKRVRIKEMGGWTLGLLIDYIYTAEIQVTEENVQALLPAAGLLQLSEV
KKACCDFLSSQLHPSNCLGIRAFADLHACCQLLTQANSYAEQHFPEVVASEEFLNLGMEQ
VSSLIASDKLTIPTEEKVFEAVIAWVNHDKDVRQEHLAQLMEHVRLPLLSREYLVQRVEE
ESLVKNSSACKDYLIEAMKYHLLPADQRALMKTARTQMRTPACCPKVMVVVGGQAPKAIR
SVECYDFEEXXXXXXXXXXXXXXXXXVVYVGGCVYAVGGFNGSLRVRTVDCYDPAADRWT
CVSSMQDRRSTLGAAVLSGLLYAVGGFDGSTGLSTVEAYNSKTDEWFHVLPMSTRRSSVG
VGVVNGILYAVGGYDGATRQCLSTVEAYNPNSNTWSYISEMGTRRSGAGVGVLKGLLYAV
GGHDGPLVRKSCEVFDPATNGWRQVADMNMCRRNAGKSMVNNLLYVVGGDDGSCNLASVE
FYNPASDKWTLLAACMSTGRSYAGVTVIDKPL
Download sequence
Identical sequences ENSGMOP00000001136 ENSGMOP00000001136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]