SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001182 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001182
Domain Number 1 Region: 216-396
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.81e-44
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.026
Further Details:      
 
Domain Number 2 Region: 90-178
Classification Level Classification E-value
Superfamily WWE domain 3.53e-16
Family WWE domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001182   Gene: ENSGMOG00000001046   Transcript: ENSGMOT00000001224
Sequence length 487
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3931:188:20607:1 gene:ENSGMOG00000001046 transcript:ENSGMOT00000001224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DITEICLFFLEGSCIHPIGECCGAHYRLPYSWEVLEGHQWTLLESSEEIEEDYCNPQKTY
STVDVEAVCFDTMTRGLQKVRRLSSISSVLQPTFLLTTEWLWYWKDENGNWYQYDSPALL
LQTNRALELEQQFQNNPQEVVEFTAGSQDYTLSLQDMIQTNKRYGTKRMVRRRPCFLSSV
NVQDIRTSRRPQNGPTNVLVMPRHWDRTQVPATGHKKVLLQDSSEEYKEVETLFRQTMTD
FDIVKIERIQNKSLWDHFQLQREQMKTKNGGRCVAERKLFHGTDSKYIDAICCSNFDWRI
CGTHGTAYGNGSYFARDASYSHNYTGNAATVRSMFVSRVLVGHHTRGKAGYVRPPSKDGG
DTLFYDSCADDIRSPKIFVVFDRAQIYPEFLLTYEEKASASDDWSWVTARAAPVVQPTPV
VKPTPVPTATPARVYGNTSSFLNSVPPPQRYAPPLQPYVSPQPTRYSPPPPTYPSPKPKP
KDSCVVC
Download sequence
Identical sequences ENSGMOP00000001182 ENSGMOP00000001182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]