SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001250 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001250
Domain Number 1 Region: 220-410
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.88e-45
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.027
Further Details:      
 
Domain Number 2 Region: 91-177
Classification Level Classification E-value
Superfamily WWE domain 1.09e-16
Family WWE domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001250   Gene: ENSGMOG00000001046   Transcript: ENSGMOT00000001296
Sequence length 410
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3931:185:8382:1 gene:ENSGMOG00000001046 transcript:ENSGMOT00000001296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDITEICLFFLEGSCIHPIGECCGAHYRLPYSWEVLEGHQWTLLESSEEIEEDYCNPQKT
YSTVDVEAVCFDTMTRGLQKVRRLSSISSVLQPTFLLTTEWLWYWKDENGNWYQYDSPLL
QTNRALELEQQFQNNPQEVVEFTAGSQDYTLSLQDMIQTNKRYGTKRMVRRRPCFLSSVN
VQDIRTREVKHLGPATPVNGPPNVQPFPNHWDKTQVPDIGYKKVLLQDSSEEYKEVETLF
RQTMTTFDIVKIERIQNKTLWDKFQLQREQMKMRNGGRYVAERKLFHGTDSKFINAICSS
NFDWRICGTHGTAYGNGSYFARDASYSHKYTGYTSTVRSMFVSQVLVGDHTRGSAGYMRP
PSKDGGDPLSKGALCRRTFYDSCVDDIHSPSIFVVFDRPQIYPEFLLSYK
Download sequence
Identical sequences ENSGMOP00000001250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]