SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001939 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001939
Domain Number 1 Region: 76-342,404-463
Classification Level Classification E-value
Superfamily Kelch motif 2.35e-53
Family Kelch motif 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001939   Gene: ENSGMOG00000001822   Transcript: ENSGMOT00000002002
Sequence length 554
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_295:17960:29786:-1 gene:ENSGMOG00000001822 transcript:ENSGMOT00000002002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKKGKKEKKVKGAEKTAAKMEKKVSKRSKREEEDLEALIAEFQNLDAKKTQVVETECPP
PSPRLNASLSPHPEKDELILFGGEFFNGKKTYLYNELYFYNIKKNSWVKSEIPNPPPPRC
AHQAVVVPQGGGQLWVFGGEFASPDGEQFYHYKDLWVLHLATHTWENIKATGAPSGRSGH
RMVLSKKQLLVFGGFHESTRDFIYYNDVYAFSLDSFSWSRLSPSGSAPSPRSACQMTCTP
DASGVIVYGGYSKLKAKKDVEKGTIHSDMFLLKRVKDDQEKWSWSRVNPAGNKPPPRSGF
SLAVGPGRAVLFGGVCDEEDDETLEGDFYNDLYLYDAGKNRWYPGQLRGTKSEKKKRRRG
KKAAGGGEEEGGAEAGEEEAVAQGPVEVVKEIVAEDGTVMTIKEAWATLVEPCSRCSAMA
TVRQGKLYLYGGMFEVGDRQFTLNDFYCLDLNKMEQWEVLVEMDPXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXADHPPVQKEEALEAYQARTEQYWVGLARANMGPEAKDKKV
GKVGLAMAKVFYED
Download sequence
Identical sequences ENSGMOP00000001939 ENSGMOP00000001939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]