SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001970 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001970
Domain Number 1 Region: 113-263
Classification Level Classification E-value
Superfamily PH domain-like 1.53e-20
Family Pleckstrin-homology domain (PH domain) 0.0084
Further Details:      
 
Domain Number 2 Region: 3-91
Classification Level Classification E-value
Superfamily EF-hand 0.000000357
Family Calmodulin-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001970   Gene: ENSGMOG00000001846   Transcript: ENSGMOT00000002034
Sequence length 549
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3294:58:46670:-1 gene:ENSGMOG00000001846 transcript:ENSGMOT00000002034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRAELLKSIWHAFTALDVDKSGKVSKSQLKVLSYNLCTLMKIPHDPVALEEHFKDDDE
GPVSNQGYMPYLNTFILDKVKEEFDRQDFDRMCWTLCARKNLDRSNLLISDDDAFKIWCI
FNFLCEDRYPLSIVSEEXXXXXXXXADRLMGGSWVEERFEDYKLELDPGESLSAWELITL
VASGHFSKGMDRQTLSMGINEVYHELILDVLKQGYIMKKGHKRKNWTERWFVLKPTSISY
YMGEDMAEKKGDIQLDGNCCVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXI
QTCVSLLRLGLPAPHREARLRRREQRGRLQAEQEDLEARMKELTAANDTKQQELEAMRKA
LEEAAARAAEEERRRLQTQTELQDRYRTDLEREKTXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAVTKKLEDAANNTRTWKHKVAEH
EGLVRLIQP
Download sequence
Identical sequences ENSGMOP00000001970 ENSGMOP00000001970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]