SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002429 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002429
Domain Number 1 Region: 274-563
Classification Level Classification E-value
Superfamily Kelch motif 8.24e-57
Family Kelch motif 0.00017
Further Details:      
 
Domain Number 2 Region: 8-127
Classification Level Classification E-value
Superfamily POZ domain 8.9e-25
Family BTB/POZ domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002429   Gene: ENSGMOG00000002280   Transcript: ENSGMOT00000002509
Sequence length 594
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_539:37083:43573:-1 gene:ENSGMOG00000002280 transcript:ENSGMOT00000002509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSPTGSRVSDPQHSQKLLRVLRSFWQEESFHDALLVVNGEELPIQKNILAAASPYIRTKL
NYNPPKEDGSTYRIELDGVSMLIMKQILDYIFSGEISLSEDTIQDMVQASDLLLLTDLKF
LCCQFLESCITAENCIGIRLFSLHYCLHHVHHVATEYLQTHLRDVALTEEFSEMPHDRLC
ELLAMEKLNVGNEKHVLEAVVRWFAHDPEDRRVHMKEVMSSVWLHGLDSSYLREQALGEP
LMREVIREYCQPALTVLPQGEALLAAFKPRGYSECIVIVGGEDRKDSKPTAAMRCMCPLY
DAHRQGWIELQPMSMARVSHGLVTAGGFLFVLGGMDEHKNILDSGEKYDPETNTWSPIPS
MMQARQNFGVVELDGMIYVLGGENKEMELVTMEMFNPYLKTWKLLPSMTMVRKIGCYATM
NKKIYAMAGGSYGKLYDSVECFDPTTQQWTGLCPLKERRFGSVACGVGKELYVFGGVQTK
EHENPDQRHMTTCKSEFYHDDMRRWMHLDDQNLCIQTSSSVYGAVAIGANIYVVGDLDTG
RSFDYIREFRRSSGTWHRTQPMLPNDLYKTECCALRIANCRLFGLQLKQGMFRV
Download sequence
Identical sequences ENSGMOP00000002429 ENSGMOP00000002429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]