SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002438 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002438
Domain Number 1 Region: 284-566
Classification Level Classification E-value
Superfamily Kelch motif 5.89e-50
Family Kelch motif 0.00088
Further Details:      
 
Domain Number 2 Region: 12-127
Classification Level Classification E-value
Superfamily POZ domain 1.14e-30
Family BTB/POZ domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002438   Gene: ENSGMOG00000002300   Transcript: ENSGMOT00000002518
Sequence length 585
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1815:16921:19377:1 gene:ENSGMOG00000002300 transcript:ENSGMOT00000002518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLSTNYNGVDAVHACTILQQLKSLYDEAQLTDIVVEVDHGQTFSCHRNVLAAISPYFRSM
FTSGLTECNQPEVRIVGVESESMNLVLDYAYTSRVTLSESNVQALFTAASIFQIPALQDL
SAQFMISRLDPQNCIGVYMFADAYGHQELRERSQDYIRKKFVCVSWEQEFLQMTKEQLVS
ILNNDDLNVEKEEHVYESIVRWLEHDRPGREGSLAEVFSQCIRLPLLDEAFLSRIPAPFA
CALSLSKDPTEAKTGLNGTNGCSQRLGMTASEMVICFDAAHKHSGKKQTVPCLDTATGRV
FKLCKPPNDFREVGILVSSENDIFIAGGYRPSNSEVSIDHRAESDFWQYEHAGNRWLPRA
PLLRARIGCRLVHCCGKLYALGGRVYEGDGRNALKSVECYDARDNCWSAVSPMPVAMEFH
SAVEYKDRIYILQGEYFFCFDPRKDYWGQLSPMVVSRSQGLAALHKNCIYYIAGICRNHQ
RTFTVEVYDIEQNTWSRKRDLPFDQATSPYIKAMLLQGKLHLFVRATQVMVEEHVFRTSR
KNSLYQYDDEADLWTKVYETPDRLWDLGRHFECVVAKLYPQCLQK
Download sequence
Identical sequences ENSGMOP00000002438 ENSGMOP00000002438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]