SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002560 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002560
Domain Number 1 Region: 307-588
Classification Level Classification E-value
Superfamily Kelch motif 4.58e-74
Family Kelch motif 0.00011
Further Details:      
 
Domain Number 2 Region: 8-62,109-165
Classification Level Classification E-value
Superfamily POZ domain 5.34e-26
Family BTB/POZ domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002560   Gene: ENSGMOG00000002423   Transcript: ENSGMOT00000002643
Sequence length 612
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2759:299166:312057:-1 gene:ENSGMOG00000002423 transcript:ENSGMOT00000002643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSGDRTSTFDPTHSDTLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAVLASCSQYFRS
LFSSHNVIHSNNKDGGGGGGKGDRASSGTPSSSPDDKMGAPGARPINNLVLQGCSSIGLR
LVLEYLYTANVTLSLDTVEEVLSVSKILNVPQITKLSVQFLNDQISVQNYKQICKIAALH
GLDETKKLANKYLVEDVLLLDLAEMCAMLDALPPPVESELALFQMSVLWLEHERESRLHH
APDLMKRLRFALIPAAELVERVQSVDFMRSDPTCQKLLLDAMNYHLMPFRQHYRQSLASR
IRSNKRMLLLAGGLPPGPDRLPSNLVQYYDDEKKTWKILTIMPYNSAHHCVVEVENFLLL
MGGEDQWNPNGKHSTNFVSRYDPRFNSWIQLPPMQERRASFFACRLEKHLYVIGGRNETG
YLSSVESYNLETNEWVYVSSLPQPLAAHAGAVHNGKIYISGGVHNGEYVSWLYCYDPVMD
VWARKQDMNTKRAIHTLAGMNDRLYAIGGNHLKGFSHLDVMLVECYDPKADQWNILQTPI
LEGRSGPGCAILDDSIFLVGGYSWSMGAYKSSTICYSPEKATWTELEGEVAEPLAGPACS
TVILPACLPFNK
Download sequence
Identical sequences ENSGMOP00000002560 ENSGMOP00000002560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]