SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002714 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002714
Domain Number 1 Region: 325-570
Classification Level Classification E-value
Superfamily Kelch motif 1.57e-59
Family Kelch motif 0.0000993
Further Details:      
 
Domain Number 2 Region: 54-162
Classification Level Classification E-value
Superfamily POZ domain 9.42e-28
Family BTB/POZ domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002714   Gene: ENSGMOG00000002567   Transcript: ENSGMOT00000002801
Sequence length 572
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1687:14365:115336:-1 gene:ENSGMOG00000002567 transcript:ENSGMOT00000002801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PALAPKPQASALAERPPKQSKKPRLPPRPLSKLFTSNKHGEXXXXXXXXXXXXXGLDCFR
GDTTLCDVILVAGDASETFPVHRVIMASASDYFKAMFTGGMREQEMEEIKLHGVTRAGLK
NVIDFIYTSRVNLNMANLQDTLEAANFLQVMPVLGFCNQLLSSEXXXXXXXXXXXXXXXX
XXXXXXXXXXEFVIQNLCELVQSGRYLELSARGMAQALASDSLKGFSEMELYGIARTWLN
HDAPCRRASIYTLMRHIRFPLMTPGQLIQISQCEDEGDEEGGETLMRSDAACVSLLLEAS
NYQMMPFLQPTLQTERTRIRSDATHLLALGGVMRQQLVVSRELRLYDGESGLWRALEPMV
VPRYQHGVALLGGFLFIVGGRSSNQSTYDTKGKTALDCAYRYDPRFDRWLQIASLNAKRT
FFHLSALKGQLYAVGGRNLSGEIDSVECYNLKRNDWTLVSHMSEPHYGHAGSVHGDLMYV
SGGITRDTFQKQLWSYDPAADAWTRRADMMELRGLHCMCAVGDRLYVMGGNHFGSTSDYD
DVLSCEFYSPAADQWTAVAPMPRGQSDVGVTL
Download sequence
Identical sequences ENSGMOP00000002714 ENSGMOP00000002714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]