SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002725 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002725
Domain Number 1 Region: 380-595
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-47
Family YWTD domain 0.000000251
Further Details:      
 
Domain Number 2 Region: 85-122
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000105
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 3 Region: 3-40
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 4 Region: 213-252
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.00032
Further Details:      
 
Domain Number 5 Region: 122-159
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000563
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 6 Region: 256-291
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000825
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 7 Region: 294-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family EGF-type module 0.0029
Further Details:      
 
Domain Number 8 Region: 336-375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000457
Family EGF-type module 0.002
Further Details:      
 
Domain Number 9 Region: 43-75
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000144
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 10 Region: 653-692
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000202
Family EGF-type module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002725   Gene: ENSGMOG00000002561   Transcript: ENSGMOT00000002811
Sequence length 862
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_500:21208:49447:1 gene:ENSGMOG00000002561 transcript:ENSGMOT00000002811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKTCATTDFACTNGQCVPARWRCDGEPECVDGSDEADATCSRHTCPPKKFDCGGAAGQCV
SLSWRCDGERDCENGAXXXXXXXXTKACPAKDFQCRNGKCVAPVFVCDGDDDCGDGSDEQ
KCSPTACGPHEFRCNDSECIPALWSCDGDNDCKDRSDEAMERCSSRTEPQGPAGAXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLTCRPDEFQCGDGSCVHGTKQCNRVH
DCPDYSDEAGCVNTTTCERPKMFRCASSECIDSRKVCDRVKDCKDWSDEPIKECDVNECL
EDNGGCSHVCRDQRIGYECDCPSGYKLLDTKTCGXXDECENRDVCSQICINYKGYYKCEC
YEGYEMDPVSKTCKAVGTSPYLMFTNRHEIRRLDLQKSEYTQVVSALKNAVALDVDVASG
TMFWCDLYQRRIYSASISQAGDPSQQLTLVDSALQAPEGLAVDWVHRNIYWTDSGNKSIS
VATADGRRRKVLVSTELSEPRSIAVDPRHGFLYWSDWGEKAKIEKAGMNGVDRQVLVSER
IEWPNGITLDLSNQRLYWVDSKLHMLSSVDLSGARRQVLLSSQQHLRHPFALSVFQXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPDTCNTGGLPNGGCEY
LCLKAPQITDHSPKYTCACPDDMELGPDMRRCAVXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXCTSAFLLWRNWRRRNTKSMNFDNPVYRKTTEDDDDEVHIGRH
SESVGHVYPARVALSSADDDYP
Download sequence
Identical sequences ENSGMOP00000002725 ENSGMOP00000002725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]